[Cusabio] Recombinant Mouse Interleukin-13(Il13),partial (Active)

[Cusabio] Recombinant Mouse Interleukin-13(Il13),partial (Active)

Code

CSB-AP004771MO

Product Details

Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 10 ng/ml.
Target Names	Il13
Uniprot No.	P20109
Research Area	Immunology
Alternative Names	Interleukin-13; IL-13; T-Cell Activation Protein P600; Il13; Il-13
Species	Mus musculus (Mouse)
Source	E.coli
Expression Region	26-131aa
Complete Sequence	SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Mol. Weight	11.7 kDa
Protein Length	Partial
Tag Info	Tag-Free
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.

Target Data

Function	Cytokine. Inhibits inflammatory cytokine production. Synergizes with IL2 in regulating interferon-gamma synthesis. May be critical in regulating inflammatory and immune responses (By similarity). Positively regulates IL31RA expression in macrophages
Subcellular Location	Secreted
Protein Families	IL-4/IL-13 family
Database Links	KEGG: mmu:16163STRING: 10090.ENSMUSP00000020650UniGene: Mm.1284